A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10199
Swiss-prot Accession number	Q9YGK2 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Thunnus obesus (Bigeye tuna)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Scombroidei;Scombridae; Thunnus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	222 Amino acids
Molecular weight	24970
References	1   Amemiya Y., Takahashi A., Kawauchi H.; "Tuna proopiomelanocortin cDNA."; Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases. 2   Amemiya Y., Takahashi A., Kawauchi H.; "Tuna proopiomelanocortin cDNA."; Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases.
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPVGRKRRPVKVYTSNGVEEESAEVFPGEM
Position of mature hormone in Pre-Hormone protein	40 Residues from position (93-132)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10629
Swiss-prot Accession number	P37204 (Sequence in FASTA format)
Description	Glycoprotein hormones alpha chain (Gonadotropin alpha chain) (GTH-alpha).
Source organism	Thunnus obesus (Bigeye tuna)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Scombroidei;Scombridae; Thunnus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Involved in gametogenesis and steroidogenesis
Protein Length	94 Amino acids
Molecular weight	10665
References	1  PubMed abstract 8138353
Domain Name	Hormone_6
Hormone Name	Glycoprotein hormones alpha chain
Mature Hormone Sequence	YPNVDLSNMGCEECTLKKNNVFSRDRPIYQCMGCCFSRAFPTPLKAMKTMTIPKNITSEATCCVAKHSYETEVAGIRVRNHTDCHCSTCYFHKS
Position of mature hormone in Pre-Hormone protein	94 Residues from position (1-94)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10977
Swiss-prot Accession number	Q9YGK2 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Thunnus obesus (Bigeye tuna)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Scombroidei;Scombridae; Thunnus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	222 Amino acids
Molecular weight	24970
References	1   Amemiya Y., Takahashi A., Kawauchi H.; "Tuna proopiomelanocortin cDNA."; Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases. 2   Amemiya Y., Takahashi A., Kawauchi H.; "Tuna proopiomelanocortin cDNA."; Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases.
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin alpha (Alpha-MSH)
Mature Hormone Sequence	SYSMEHFRWGKPVGR
Position of mature hormone in Pre-Hormone protein	15 Residues from position (93-107)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10978
Swiss-prot Accession number	Q9YGK2 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Thunnus obesus (Bigeye tuna)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Scombroidei;Scombridae; Thunnus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	222 Amino acids
Molecular weight	24970
References	1   Amemiya Y., Takahashi A., Kawauchi H.; "Tuna proopiomelanocortin cDNA."; Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases. 2   Amemiya Y., Takahashi A., Kawauchi H.; "Tuna proopiomelanocortin cDNA."; Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases.
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Lipotropin beta (Beta-LPH)
Mature Hormone Sequence	ELASELLAAAEEEEEKAQEVMAEEEEEQKQLLQEKKDGSYKMKHFRWSGPPASKRYGGFMKSWDERSQRPLLTLFKNVINKDGQQQK
Position of mature hormone in Pre-Hormone protein	87 Residues from position (136-222)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10979
Swiss-prot Accession number	Q9YGK2 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Thunnus obesus (Bigeye tuna)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Scombroidei;Scombridae; Thunnus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	222 Amino acids
Molecular weight	24970
References	1   Amemiya Y., Takahashi A., Kawauchi H.; "Tuna proopiomelanocortin cDNA."; Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases. 2   Amemiya Y., Takahashi A., Kawauchi H.; "Tuna proopiomelanocortin cDNA."; Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases.
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Lipotropin gamma (Gamma-LPH)
Mature Hormone Sequence	ELASELLAAAEEEEEKAQEVMAEEEEEQKQLLQEKKDGSYKMKHFRWSGPPAS
Position of mature hormone in Pre-Hormone protein	53 Residues from position (136-188)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	10980
Swiss-prot Accession number	Q9YGK2 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Thunnus obesus (Bigeye tuna)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Scombroidei;Scombridae; Thunnus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	222 Amino acids
Molecular weight	24970
References	1   Amemiya Y., Takahashi A., Kawauchi H.; "Tuna proopiomelanocortin cDNA."; Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases. 2   Amemiya Y., Takahashi A., Kawauchi H.; "Tuna proopiomelanocortin cDNA."; Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases.
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin beta (Beta-MSH)
Mature Hormone Sequence	DGSYKMKHFRWSGPPAS
Position of mature hormone in Pre-Hormone protein	17 Residues from position (172-188)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10981
Swiss-prot Accession number	Q9YGK2 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Thunnus obesus (Bigeye tuna)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Scombroidei;Scombridae; Thunnus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	222 Amino acids
Molecular weight	24970
References	1   Amemiya Y., Takahashi A., Kawauchi H.; "Tuna proopiomelanocortin cDNA."; Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases. 2   Amemiya Y., Takahashi A., Kawauchi H.; "Tuna proopiomelanocortin cDNA."; Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases.
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Beta-endorphin
Mature Hormone Sequence	YGGFMKSWDERSQRPLLTLFKNVINKDGQQQK
Position of mature hormone in Pre-Hormone protein	32 Residues from position (191-222)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	10982
Swiss-prot Accession number	Q9YGK2 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Thunnus obesus (Bigeye tuna)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Scombroidei;Scombridae; Thunnus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	222 Amino acids
Molecular weight	24970
References	1   Amemiya Y., Takahashi A., Kawauchi H.; "Tuna proopiomelanocortin cDNA."; Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases. 2   Amemiya Y., Takahashi A., Kawauchi H.; "Tuna proopiomelanocortin cDNA."; Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases.
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Met-enkephalin
Mature Hormone Sequence	YGGFM
Position of mature hormone in Pre-Hormone protein	5 Residues from position (191-195)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	11129
Swiss-prot Accession number	P68957 (Sequence in FASTA format)
Description	Glucagon.
Source organism	Thunnus obesus (Bigeye tuna)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Scombroidei;Scombridae; Thunnus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level
Protein Length	29 Amino acids
Molecular weight	3508
References	1  PubMed abstract 1916209
Domain Name	Hormone_2
Hormone Name	Glucagon
Mature Hormone Sequence	HSEGTFSNDYSKYLETRRAQDFVQWLKNS
Position of mature hormone in Pre-Hormone protein	29 Residues from position (1-29)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated